current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: 5iqk_A mol:protein length:271 beta-lactamase Rm3, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270
# Score Template Links and tools%idFirst TPGCEVCATWNADQAPFRLFGNTYYVGMKGLSSVLVTSPQGHVLIDGGLPESAPKIIANIGALGFRIEDVKLILNSHGHIDHAGGLAELQRRSNALVAASPSAALDLASGEVGPDDPQYHALPKYPPVKDMRLARDGGQFNVGPVYLTAHATPGHTPGGLSWTWQSCDGPRCLNMVYADSINAVSRPGFKFSASSEYPNALADLRHSFETLEKLPCDVLISAHPEASQLWQRLEASATGGSDAFVDPQACRAYVAAARTLLDSRLDQEKQQLast
1 -112.0005iqk_A mol:protein length:271 beta-lactamase Rm3  ali model  100  1TPGCEVCATWNADQAPFRLFGNTYYVGMKGLSSVLVTSPQGHVLIDGGLPESAPKIIANIGALGFRIEDVKLILNSHGHIDHAGGLAELQRRSNALVAASPSAALDLASGEVGPDDPQYHALPKYPPVKDMRLARDGGQFNVGPVYLTAHATPGHTPGGLSWTWQSCDGPRCLNMVYADSINAVSRPGFKFSASSEYPNALADLRHSFETLEKLPCDVLISAHPEASQLWQRLEASATGGSDAFVDPQACRAYVAAARTLLDSRLDQEKQQ 271
2 -104.0003vpe_A mol:protein length:262 Metallo-beta-lactamase  ali model follow..  45  1.....QDRDWSSPQQPFTIYGNTHYVGTGGISAVLLSSPQGHILVDGTTEKGAQVVAANIRAMGFKLSDVKYILSTHSHEDHAGGISAMQKLTGATVLAGAANVDTLRTGVSPKSDPQFGSLSNFPGSAKVRAVADGELVKLGPLAVKAHATPGHTEGGITWTWQSCEQGKCKDVVFADSLTAVSADSYRF---SDHPEVVASLRGSFEAVEKLSCDIAIAAHPEVNDMWTRQQRAAKEGNSAYVDNGACRAIAAAGRKRLETRLASEKR. 262
3 -102.0001jt1_A mol:protein length:263 FEZ-1, class B3 metallo-beta-lactamase  ali model follow..  29  1......AYPMPNPFPPFRIAGNLYYVGTDDLASYLIVTPRGNILINSDLEANVPMIKASIKKLGFKFSDTKILLISHAHFDHAAGSELIKQQTKAKYMVMDEDVSVILSGGKSDFHYANDSSTYFTQSTVDKVLHDGERVELGGTVLTAHLTPGHTRGCTTWTMKLKDHGKQYQAVIIGSIGVN--PGYKLVDNITYPKIAEDYKHSIKVLESMRCDIFLGSHAGMFDLKNKYVLLSKGQNNPFVDPTGCKNYIEQKANDFYTELKKQET. 262
4 -99.7004p62_A mol:protein length:295 Metallo-beta-lactamase AIM-1  ali model follow..  44  28SRGCADDAGWNDPAMPQKVYGNTWYVGTCGISALLVTSDAGHILVDAATPQAGPQILANIRALGFRPEDVRAIVLSHEHFDHAGSLAELQKATGAPVYARAPAIDTLKRGLPDRTDPQFEVAEPVAPVANIVTLADDGVVSVGPLALTAVASPGHTPGGTSWTWRSCEGDDCRQMVYADSLTAISDDVYRYSDDAAHPGYLAAFRNTLARVAALDCDILVTPHPSASGLWNRIG---PRAAAPLMDTTACRRYAQGARQRLEKRLAEEAA. 294
5 -99.7005aeb_A mol:protein length:272 LRA-12  ali model follow..  26  8KEPTVSNADWSKPYRPFRIAGNLYYIGTYDLACYLITTKQGNIIVNTGLAASALQIKNNIKALGFKLTDTKILLTTQAHYDHLGAMAEIKKITGAKLMADEGDATVMADGGSS-DYAFGGHGSMFEPIIADRLLHDKDTIQLGDTKLVMLHHPGHTKGSCSFLFDTKDEQRSYRILIANMPTIVI--EKKFSEVSSYPGIAKDYAYTLQAMKNLSFDIWVASHASQFSMHSKHKPGDGYNPKSFMDRKGYDESLDKLQKEYEKHLNEN... 272
6 -98.9004awy_B mol:protein length:303 METALLO-BETA-LACTAMASE AIM-1  ali model follow..  44  28SRGCADDAGWNDPAMPLKVYGNTWYVGTCGISALLVTSDAGHILVDAATPQAGPQILANIRALGFRPEDVRAIVFSHEHFDHAGSLAELQKATGAPVYARAPAIDTLKRGLPDRTDPQFEVAEPVAPVANIVTLADDGVVSVGPLALTAVASPGHTPGGTSWTWRSCEGDDCRQMVYADSLTAISDDVFRYSDDAAHPGYLAAFRNTLARVAALDCDILVTPHPSASGLWNRIG---PRAAAPLMDTTACRRYAQGARQRLEKRLAEEAAT 295
7 -96.8003lvz_A mol:protein length:294 Blr6230 protein  ali model follow..  30  25DFLAVAMKKWTAPFEPFQLIDNIYYVGTDGIAVYVIKTSQGLILMDTAMPQSTGMIKDNIAKLGFKVADIKLILNTHAHLDHTGGFAEIKKETGAQLVAGERDKPLLEGGYYPGDEK--NEDLAFPAVKVDRAVKEGDRVTLGDTTLTAHATPGHSPGCTSWEMTVKDGKEDREVLFFCSGTVALNRL---VGQPTYAGIVDDYRATFAKAKAMKIDVLLGPHPEVYGMQAKRAEMKDGAPNPFIKPGELVTYATSLSEDFDKQLAKQTAA 290
8 -92.3001sml_A mol:protein length:269 PROTEIN (PENICILLINASE)  ali model follow..  38  8LRAYTVDASWLQPMAPLQIADHTWQIGTEDLTALLVQTPDGAVLLDGGMPQMASHLLDNMKARGVTPRDLRLILLSHAHADHAGPVAELKRRTGAKVAANAESAVLLARGG--SDDLHFGDGITYPPANADRIVMDGEVITVGGIVFTAHFMAGHTPGSTAWTWTDTRNGKPVRIAYADSLSAPGYQLQG---NPRYPHLIEDYRRSFATVRALPCDVLLTPHPGASNWDYAAGA------RAGAKALTCKAYADAAEQKFDGQLAKETAG 267
9 -51.7002zwr_A mol:protein length:207 Metallo-beta-lactamase superfamily protein  ali model follow..  21  4.....................FPVTLGPLQENAYLVETGEGPVLIDPG--DEPEKLLALFQTTGLI---PLAILLTHAHFDHVGAVAPLVEALDLPVYLHPLDLPLYEG---ADLAARAWGLAIPKPPLPVRPLEEGMRL----FGFQVLHLPGHSPGHVAFYDPEGAQVFSGDLLFRGSVGRYDLPGADP----------KALFASLKRLLSLPPETVHPGHGPGTTLGLEART------NPFLTGLEWEA................... 207
10 -48.5002q0j_A mol:protein length:321 Quinolone signal response protein  ali model follow..  17  15.........MLRLSAPGQLDDDLCLLGDVQVPVFLLRLGESWALVEGGISRDAELVWADLCRWVADPSQVHYWLITHKHYDHCGLLPYLCPRLNVQVLASERTCQAWKSESALLRAEQRLPEACAWDALPVRAVADGEWLELGPHRLQVIEAHGHSDDHVVFYDVRRRR-----LFCGDALGEFDEAEGVWR--PLVFDDMEAYLESLERLQRLPTLQLIPGHGGAADGAESAYTECLRLCRRLLWRQSMGESLDELSEELHRAWGGQSVD 289
11 -48.3003adr_A mol:protein length:261 Putative uncharacterized protein ST1585  ali model follow..  15  20..............................ATVYVMCGEKLTVMIDAGVSNSIADFSF--------LDKLDYIVLTHLHIDHIGLLPELLQVYKAKVLVKSGFKKYLTSEDGLKK-YVYGGLEKKLDQDKVIEVEGNEEFDLGGYRMRLIYTPGHARHHMSVLVDDF-TGDSAGAYFNGVVIPTTPPVIDY----------KMYMESLKRQIELKPKVVGFAHGGLVSHLKQMLSKEEIQINVDIGGVAGEILRKQIEVNLRGLRESKKS. 260
12 -45.9002xf4_A mol:protein length:210 HYDROXYACYLGLUTATHIONE HYDROLASE  ali model follow..  23  4.....................RIIPVTAFSQNCSLIWCEQTAALVDPG--GDAEKIKQEVDASGVT---LMQILLTHGHLDHVGAASELAQHYGVPVIGPEKEDEFWLQG--LPAQSRMFGLDECQPLTPDRWLNDGDRVSVGNVTLQVLHCPGHTPGHVVFFDEQSQLLISGDVIFKGGVGRSDFPR------GDHTQLIDAIK---RKLLPLGDDVFIPGHGPLSTLGYERLH------NPFLQD........................ 210
13 -42.1001ztc_A mol:protein length:221 hypothetical protein TM0894  ali model follow..  15  29..............................STVVYLEHKDRRIIIDPGNLSSMDELEEKFSELGISPDDITDVLFTHVHLDHIFNSVLFE---NATFYVHEVYKTKNYL-SFGTIVGRIYSKVISSWKNVVLLKGEESLFDEK---VKVFHTPWHAREHLSFLLDTENAG---RVLITGDI----TPNRLSYYDIIKGYGSVQVKNFLDRVGRI--DLLVFPH................................................ 205
14 -39.7002zo4_A mol:protein length:317 Metallo-beta-lactamase family protein  ali model follow..  19  3.................ALLPGLYLLPLKTVNLYLLQGAGEVALVDTALRAARGALELHLAELGLCFQDVKTILLTHHHPDHYGLSGFFEG-LGARVFLHEEEFARGHRFWREPEAFAEASWRLFHPPQNPLPLRDGEALEVAGKRLRVLWTPGHADGHAAFYLEEEG------VLLAGDALLEKVSPNVGLWAYTRENPLKDFLRSLDRLADLGARVAYAGHFPIADVRQRAEELKAHHQARL---EALLALLDGPKTAWE......... 270
15 -36.6002p97_A mol:protein length:201 Hypothetical protein  ali model follow..  17  20..........................RNIDFNGFAWIRPEGNILIDP--VALSNHDWKHLESLG----GVVWIVLTNS--DHVRSAKEIADQTYTKIAGPVAEKENF-------------------PIYCDRWLSDGDELVPG---LKVMELQGKTPGELALLLEE-------TTLITGDLVRAYRAGGLEILPDEKLMNKQKVVASVRRLAALKVEAVLVGDGWSVFRDGRDRLKE.................................. 195
16 -36.3002r2d_A mol:protein length:276 Zn-dependent hydrolases  ali model follow..  13  43..............................VSAYLIQCTDATVLYDTGCHPECCNLPERLRQLGLSPDDISTVVLSHLHNDHAGCVEYFGK---SRLIAHEDEFATAVRYFATGDHSSPYIVKDIEARNWDLVGRDERERELAPGVNLLNFGTGHASGMLGLAVRLEKQP---GFLLVSDACYTATNYGPPARRAGVLHDTIGYDRTVSHIRQYAESTVLFGH................................................ 259
17 -35.6003aj3_A mol:protein length:274 4-pyridoxolactonase  ali model follow..  19  35..............................VYSILIEHAEGRFLIDTGYDYDHQTIPGALGLLGLEPRDIDVVVNSHFHFDHCGGNKYFP---HAKKICHRSEVPQACNPQPFEHEGTTRANSTFEGIDGDVDLARG---------VKLISTPGHSIGHYSLLVEFPRRK----PILFTIDAAYTQKSLETLCQAAFHIDPVAGVNSMRKVKKLAEDELMYSH................................................ 252
18 -35.3004v0h_A mol:protein length:266 METALLO-BETA-LACTAMASE DOMAIN-CONTAINING PROT  ali model follow..  21  68..............................AEAALEEAARGPILVDTGGPWAREALLGALAGQGVAPGDVTLVVGTHGHSDHIGNLGLFPG---AALLVSHDFCLPGGR-------------------YLPHGLGEGQPLRLGP-GLEVWATPGHGGQRDVSV--VVAGTALGTVVVAGDV---FERDGDEDSWQALSEDPAAQERSRKRVLVV-ADVVVPGHGPPFRVLREASQ.................................... 243
19 -35.1004chl_A mol:protein length:238 PERSULFIDE DIOXYGENASE ETHE1, MITOCHONDRIAL  ali model follow..  21  21................................TYLLGDRESAVLIDPVL-ETAPRDAQLIKELGLR---LLYAVNTHCHADHITGSGLLRSLLPGCQSVISR----------------------LSGAQADLHIEDGDSIRFGRFALETRASPGHTPGCVTFVLNDHSMAFTGDALLIRGCGRTDFQQG---------CAKTLYHSVHEKIFTLPGDCLIPAHDYHGFTVSTVEEERTLNPRLTLSCEEFVKIMGNLNLPKPQQIDFA... 224
20 -35.0003dha_A mol:protein length:254 N-Acyl Homoserine Lactone Hydrolase  ali model follow..  18  39..............................VWCYLLETEEGPILVDTGMPESADRIVNILKRVGYEPDDLLYIISSHLHFDHAGGNGAFT---NTPIIVQRTEYEAALHREEYMKE-CILPHLNYKIIEGDYEVVPG---------VQLLYTPGHSPGHQSLFIETEQSGSV--LLTIDASYTKENFEDEVPFAGFDPELALSSIKRLKEVVKKEKPIIFFGH................................................ 239
21 -34.9002br6_A mol:protein length:252 AIIA-LIKE PROTEIN  ali model follow..  18  37..............................VWCYLLETEEGPILVDTGMPESADRIVNILKRVGYEPDDLLYIISSHLHFDHAGGNGAFT---NTPIIVQRTEYEAALHREEYMKE-CILPHLNYKIIEGDYEVVPG---------VQLLYTPGHSPGHQSLFIKTEQSGSV--LLTIDASYTKENFEDEVPFAGFDPELALSSIKRLKEVVKKEKPIIFFGH................................................ 237
22 -34.2004ysb_A mol:protein length:233 Metallo-beta-lactamase family protein  ali model follow..  19  1..................MIFRQLFDSESSTYTYLIGDEATAVLIDPVL-EQVDRDLQMVAELDLT---LTHVFDTHVHADHITASGALRERTQATVVGSVNGASCA-----------------------NVQVRHGDEVRVGQLVFQVLATPGHTDDSISYLLG--DRVFTGDALLVRGNGRTDFQNG---------NASQLYDSLTRVLFTLPDETLVPGHDYKGRTVTSIAEEKRH--NPRVAGKSREEFIHIMENL........... 205
23 -33.9004bp0_A mol:protein length:250 METALLO-B-LACTAMASE  ali model follow..  11  2.PKSSDHVDLPYNLTATKIDSDVFVVDFYSSNVLVAKMLDGVVIVSSPFENLTQTLMDWVAKT--MKPKKVVAINTHFHLDGTGGNEIYKKM-GAETWSSDLTKQLRLEENKKEDLKRRILSSHPVPADNVFDLKQGKVFSFSNELVEVSFPPAHSPDNVVVYFPKKKLLFGGCMIKPKELGYLG------------DANVKAWPDSARRLKKFDAKIVIPGHGEWGG........................................... 230
24 -33.8001xm8_A mol:protein length:254 glyoxalase II  ali model follow..  18  14................................AYILHDEDTVGVVDPS---EAEPIIDSLKRSGRN---LTYILNTHHHYDHTGGNLELKDRYGAKVIGSAMDKDRIPG--------------------IDMALKDGDKWMFAGHEVHVMDTPGHTKGHISLYFPGSRAIFTGDTMFSLSCGKL------------FEGTPKQMLASLQKITSLPDDTSICGHEYTLSNSKFALSLEPNNEVLQSYAAHVAELRSKKLPTIPTTVKMEKA. 216
25 -33.4005a87_A mol:protein length:248 METALLO-BETA-LACTAMASE VIM-5  ali model follow..  16  23..........VGEVRLYQIADGVWSHAVYPSNGLIVRDGDELLLIDTAWAKNTAALLAEIEKQ----LPVTRAVSTHFHDDRVGGVDVLRKA-GVATYASPSTRRLAEAEGN-----------EIPTHSLEGLSSSGDAVRFGPVEL-FYPGAAHSTDNLVVYVPSANVLYGGCAVLALSRTSAGNVA---------DADLAEWPTSVERIQKHEAEVVIPGHGLPGG----------------------LDLLQHTANVVTAHKNRSVAE 248
26 -33.4003q6v_A mol:protein length:233 Beta-lactamase  ali model follow..  19  3..........EKNLTLTHFKGPLYIVEYVQENSMVYIGTDGITIIGATTPETAETLYKEIRKV--SPLPINEVINTNYHTDRAGGNAYWKTL-GAKIVATQMTYDLQKSQWGSIVNFTRQGNNKYPNLEKSL-TVFPGDFNLQNGSIRAMYLEAHTKDGIFVYFPAER------VLYGNCILKENLGNMSFANRTEYPKTLEKLK-GLIEQGELKVDSIIAGHDTPIHDVGLIDHYLT................................. 226
27 -32.9002gcu_A mol:protein length:245 Putative hydroxyacylglutathione hydrolase 3  ali model follow..  16  1................MKLLFRQLFENESSTFTYLLHPDKPALLIDPVD-KTVDRDLKLIDELGLK---LIYAMNTHVHADHVTGTGLLKTKLPGVKSVISKA----------------------SGSKADLFLEPGDKVSIGDIYLEVRATPGHTAGCVTYVTGEGADAFTGDAVLIRGCGRTDFQEG---------SSDQLYESVHSQIFTLPKDTLIPAHDYKGFEVSTVGEEMQHNPRLTKDKETFKTIMSNLNLSYPKMIDVA... 228
28 -32.7004ad9_A mol:protein length:289 BETA-LACTAMASE-LIKE PROTEIN 2  ali model follow..  18  20..................LGCNPGPMTLQGTNTYLVGTGPRRILIDTGEPAIPEYISCLKQALTEFNTAIQEIVVTHWHRDHSGGIGDICKSINNDTTYCIKKLPRNPQREEIIGN----------GEQQYVYLKDGDVIKTEGATLRVLYTPGHTDDHMALLLEEENAIFSGDCILGEGTTVFE---------------LYDYMNSLKELLKIKADIIYPGHGPVIH-------------NAEAKIQQYISHRNIREQQILTLFRENFEK 235
29 -32.6004wd6_A mol:protein length:233 Metallo-beta-lactamase  ali model follow..  10  4..........VPELRIEKVKENIFLHGLVSSNGLVVIDKGNAFIVDTPSDRDTETLVHWIRKNG---YELLGSVSTHWHEDRTAGIKWLNDQ-SISTYATTSTNHLLKENKK----------------EPAKYTLKGNESTLVDGLIEVFYPGGHTIDNVVVWLPKSKILFGGCFVRSLDSEGLGYTG---------EAHIDQWSRSAQNALSREAQIVIPGHGKIGDIAL----------------KHTKSLAETASNKSIQPNANASAD 233
30 -32.4003l6n_A mol:protein length:219 metallo-beta-lactamase  ali model follow..  13  3..........KDFVIEPPIKNNLHIYKEYSANSMYLVTKKGVVLFDVPWEKVYQSLMDTIKKR--HNLPVVAVFATHSHDDRAGDLSFFNNK-GIKTYATAKTNEFLKKDGK---------------ATSTEIIKTGKPYRIGGEEFVVDFLEGHTADNVVVWFPKYNVLDGGCLVKSNSATDLGYIK---------EANVEQWPKTINKLKAKKATLIIPGHDEWKG........................................... 205
31 -32.4004uwo_B mol:protein length:266 METALLO-BETA-LACTAMASE VIM-26  ali model follow..  16  41..........VGEVRLYQIADGVWSHAVYPSNGLIVRDGDELLLIDTAWAKNTAALLAEIEKQ----LPVTRAVSTHFHDDRVGGVDVLRAA-GVATYASPSTRRLAEAEGN-----------EIPTHSLEGLSSSGDAVRFGPVEL-FYPGAAHSTDNLVVYVPSANVLYGGCAVLELSSTSAGNVA---------DADLAEWPTSVERIQKHEAEVVIPGHGLPGG----------------------LDLLQHTANVVKAHKNRSVAE 266
32 -32.2002nze_A mol:protein length:222 Beta-lactamase II  ali model follow..  14  8..........TGTISISQLNKNVWVHTELGSNGLVLNTSKGLVLVDSSWDDKTKELIEMVEKK--FQKRVTDVIITHAHADHIGGIKTLKER-GIKAHSTALTAELAKKNGY---------------EEPLGDLQTVTNLKFGNMKVETFYPKGHTEDNIVVWLPQYNILVGGSLVKSTSAKDLGNVA---------DAYVNEWSTSIENVLKRNINAVVPGHGEVGD........................................... 210
33 -31.9004gyq_A mol:protein length:243 Beta-lactamase NDM-1  ali model follow..  13  19..........FGDLVFRQLAPNVWQHGAVASNGLIVRDGGRVLVVDTATDDQTAQILNWIKQE--INLPVALAVVTHAHQDKMGGMDALHAA-GIATYANALSNQLAPQEGMVAAQHSL-------TFAANGWVEPATAPNFGPLKV-FYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLG---------AADTEHYAASARAFGAAKASMIVMSHSAPDS........................................... 228
34 -31.9002yz3_A mol:protein length:266 Metallo-beta-lactamase  ali model follow..  15  41..........VGEVRLYQIADGVWS-AVYPSNGLIVRDGDELLLIDTAWAKNTAALLAEIEKQ----LPVTRAVSTHFHDDRVGGVDVLRAA-GVATYASPSTRRLAEVEGN-----------EIPTHSLEGLSSSGDAVRFGPVEL-FYPGAAHSTDNLVVYVPSASVLYGGCAIYELSRTSAGNVA---------DADLAEWPTSIERIQQHEAQFVIPGHGLPGG----------------------LDLLKHTTNVVKAHTNRSVVE 266
35 -31.8004ubq_A mol:protein length:229 Beta-lactamase  ali model follow..  17  5..........LPDLKIEKLEEGVYVHGVVSKHGLVVLVNTDAYLIDTPTATDTEKLVNWFVERG---YKIKGTISSHFHSDSTGGIEWLNSQ-SIPTYASELTNELLKKDGKVQAKNSF----------------SGVSYWLVKNKIEVFYPPGHTQDNVVVWLPEKKILFGGCFVKPDGLGNLG------------DANLEAWPKSAKILMSKKAKLVVSSHSEIGD........................................... 203
36 -31.8003spu_A mol:protein length:265 Beta-lactamase NDM-1  ali model follow..  12  10GQQMETGDQRFGDLVFRQLAPNVWQHGAVASNGLIVRDGGRVLVVDTATDDQTAQILNWIKQE--INLPVALAVVTHAHQDKMGGMDALHAA-GIATYANALSNQLAPQEGMVAAQHSL-------TFAANGWVEPATAPNFGPLKV-FYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLG---------DADTEHYAASARAFGAAKASMIVMSHSAPDSRAA----------------THTARMADKLRKLVPRGSAAAALE 257
37 -31.7002y87_A mol:protein length:265 METALLO-B-LACTAMASE  ali model follow..  13  40..........VGEVRLYKIGDGVWSHTVYSSNGLIVRDADELLLIDTAWAKNTVALLAEIEKQ----LPVTRSISTHFHDDRVGGVDVLRAA-GVATYTSPLTRQLAEAAGN-----------EVPAHSLKALSSSGDVVRFGPVEV-FYPGAAHSGDNLVVYVPAVRVLFGGCAVHEASRESAGNVA---------DANLAEWPATIKRIQQREAEVVIPGHGLPGG----------------------LELLQHTTNVVKTHKVRPVAE 265
38 -31.7002uyx_A mol:protein length:228 BETA-LACTAMASE II  ali model follow..  13  4KVEKTVIKNETGTISISQLNKNVWVHTELGSNGLVLNTSKGLVLVDSSWDDKTKELIEMVEKK--FQKRVTDVIITHAHASRIGGIKTLKER-GIKAHSTALTAELAKKNGY---------------EEPLGDLQTVTNLKFGNMKVETFYPKGHTEDNIVVWLPQYNILVGGCLVKSTSAKDLGNVA---------DAYVNEWSTSIENVLKRNINAVVPGHGEVGD........................................... 216
39 -31.7001m2x_A mol:protein length:223 class B carbapenemase BlaB-1  ali model follow..  15  6.................KLKDNLYVYTKYAANAVYLVTDKGVVVIDCPWGEDFKSFTDEIYKK--HGKKVIMNIATHSHDDRAGGLEYFGKI-GAKTYSTKMTDSILAKENK---------------PRAQYTFDNNKSFKVGKSEFQVYYPKGHTADNVVVWFPKEKVLVGGCIIKSADSKDLGYIG---------EAYVNDWTQSVHNIQQKGAQYVVAGHDDWKD........................................... 201
40 -31.7003fcz_A mol:protein length:222 Beta-lactamase 2  ali model follow..  14  8..........TGTISISQLNKNVWVHTELGSSGLVLNTSKGLVLVDSSWDDKTKELIEMVEKK--FQKRVTDAIITHAHADRIGGIKTLKER-GIKAHSTALTAELAKKNGY---------------EEPLGDLQTVTNLKFGNMKVETFYPKGHTEDNIVVWLPQYNILVGGCLVKSTSAKDLGNVA---------DAYVNEWSTSIENVSKRNINAVVPSHGEVGD........................................... 210
41 -31.6001znb_A mol:protein length:232 METALLO-BETA-LACTAMASE  ali model follow..  11  1...AQKSVKISDDISITQLSDKVYTYGMVPSNGMIVINNHQAALLDTPINDATETLVNWVADS--LHAKVTTFIPNHWHGDCIGGLGYLQKK-GVQSYANQMTIDLAKEKGL---------------PVPEHGFTDSLTVSLDGMPLQCYYLGGHATDNIVVWLPTENILFGGCMLKDNQATSIGNIS---------DADVTAWPKTLDKVKAKSARYVVPGHGDYGG........................................... 211
42 -31.6004rl2_A mol:protein length:246 Beta-lactamase NDM-1  ali model follow..  13  22..........FGDLVFRQLAPNVWQHGAVASNGLIVRDGGRVLVVDTATDDQTAQILNWIKQE--INLPVALAVVTHAHQDKMGGMDALHAA-GIATYANALSNQLAPQEGMVAAQHSL-------TFAANGWVEPATAPNFGPLKV-FYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLG---------DADTEHYAASARAFGAAKASMIVMSHSAPDS........................................... 231
43 -31.6001a7t_A mol:protein length:232 METALLO-BETA-LACTAMASE  ali model follow..  11  1...AQKSVKISDDISITQLSDKVYTYGMVPSNGMIVINNHQAALLDTPINDATEMLVNWVTDS--LHAKVTTFIPNHWHGDCIGGLGYLQRK-GVQSYANQMTIDLAKEKGL---------------PVPEHGFTDSLTVSLDGMPLQCYYLGGHATDNIVVWLPTENILFGGCMLKDNQTTSIGNIS---------DADVTAWPKTLDKVKAKSARYVVPGHGNYGG........................................... 211
44 -31.6001x8h_A mol:protein length:228 Beta-lactamase  ali model follow..  18  1...........AGMSLTQVSGPVYVVYYVQENSMVYFGAKGVTVVGATTPDTARELHKLIKRV--SRKPVLEVINTNYHTDRAGGNAYWKSI-GAKVVSTRQTRDLMKSDWAEIVAFTRKGLPEYPDLPPNVVHDGDFTLQEGKVRA-FYAGPAHTPDGIFVYFPDEQ------VLYGGCILKEKLGNLS-------FADVKAYPQTLERLKALPIKTVIGGHDSPLHGPELIDHYEA................................. 219
45 -31.5004f6h_A mol:protein length:236 Beta-lactamase  ali model follow..  13  4..........LPDLKIEKLDEGVYVHGVVPKHGLVVLVNAEAYLIDTPTAKDTEKLVTWFVERG---YKIKGSISSHFHSDSTGGIEWLNSR-SIPTYASELTNELLKKDGKVQATNSF----------------SGVNYWLVKNKIEVFYPPGHTPDNVVVWLPERKILFGGGFIKPYGLGNLG------------DANIEAWPKSAKLLKSKKAKLVVPSHSEVGDTLEQAVKGLNESKKPSKPSNWSHPQFEK............... 236
46 -31.5003rkk_A mol:protein length:237 Beta-lactamase NDM-1  ali model follow..  13  3ANYMETGDQRFGDLVFRQLAPNVWQHGAVASNGLIVRDGGRVLVVDTATDDQTAQILNWIKQE--INLPVALAVVTHAHQDKMGGMDALHAA-GIATYANALSNQLAPQEGMVAAQHSL-------TFAANGWVEPATAPNFGPLKV-FYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLG---------DADTEHYAASARAFGAAKASMIVMSHSAPDS........................................... 222
47 -31.4005a5z_A mol:protein length:251 BETA-LACTAMASE NDM-1  ali model follow..  13  19..........FGDLVFRQLAPNVWQHGAVASNGLIVRDGGRVLVVDTATDDQTAQILNWIKQE--INLPVALAVVTHAHQDKMGGMDALHAA-GIATYANALSNQLAPQEGMVAAQHSL-------TFAANGWVEPATAPNFGPLKV-FYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLG---------DADTEHYAASARAFGAAKASMIVMSHSAPDS........................................... 228
48 -31.0004tyf_A mol:protein length:231 NDM-4  ali model follow..  13  7..........FGDLVFRQLAPNVWQHGAVASNGLIVRDGGRVLVVDTATDDQTAQILNWIKQE--INLPVALAVVTHAHQDKMGGMDALHAA-GIATYANALSNQLAPQEGLVAAQHSL-------TFAANGWVEPATAPNFGPLKV-FYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLG---------DADTEHYAASARAFGAAKASMIVMSHSAPDS........................................... 216
49 -31.0002ynt_B mol:protein length:233 GIM-1 PROTEIN  ali model follow..  12  4..........HKPLEVIKIEDGVYLHGLVDSNGLVVLDNNQAYIIDTPWEEDTKLLLSWATDRG---YQVMASISTHSHEDRTAGIKLLNSK-SIPTYTSELTKKLLAREGKPVPTHYF----------------KDDEFTLGNGLIELYYPAGHTEDNIVAWLPKSKILFGGCLVRSHEWEALGYVG---------DASISSWADSIKNIVSKPIQMVVPGHGKVGSSDI----------------DHTIDLAESASNKLMQPTAEASAD 233
50 -31.0004exs_B mol:protein length:272 Beta-lactamase NDM-1  ali model follow..  13  36GQQMETGDQRFGDLVFRQLAPNVWQHGAVASNGLIVRDGGRVLVVDTATDDQTAQILNWIKQE--INLPVALAVVTHAHQDKMGGMDALHAA-GIATYANALSNQLAPQEGMVAAQHSL-------TFAANGWVEPATAPNFGPLKV-FYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLG---------DADTEHYAASARAFGAAKASMIVMSHSAPDS........................................... 255
51 -30.8005acp_A mol:protein length:250 GIM-1 PROTEIN  ali model follow..  12  13..ALPALAQGHKPLEVIKIEDGVYLHGLVDSNGLVVLDNNQAYIIDTPSEEDTKLLLSWATDRG---YQVMASISTHSHEDRTAGIKLLNSK-SIPTYTSELTKKLLAREGKPVPTHYF----------------KDDEFTLGNGLIELYYPAGHTEDNIVAWLPKSKILFGGCLVRSHEREGLGYVG---------DASISSWADSIKNIVSYPIQMVVPGHGKVGSSDI----------------DHTIDLAESASNKLMQPTAEASAD 250
52 -30.4005i0p_A mol:protein length:366 Beta-lactamase domain protein  ali model follow..  13  20...........AAGDTFEVAPGVRWLSLDHINLWLLRGQAGWTIVDCGISEAIRTHWEQIFDRHLDGLPVLRVLVTHCHPDHFGLANWLCEGGNVRLWMTLGEYMFGCL-DKLRSRRSYYSDLVPAVPPRYRRLREGDAVKIGARTWRVVTGYGHSPEHCALHSEADG------LISGDMVLPRISTNVSVFDLEPEANPLALYLESLGRYETMAPDLVLPSHGPFRGVRTRIAQLRAHHDARLEEVRVACAEKPMSAAGIVPIMFRRRE. 319
53 -29.5003esh_A mol:protein length:280 Protein similar to metal-dependent hydrolase  ali model follow..  17  47.............................PTHPILIQTAQYNLIIDAGIGNEESHIIADLANYNLTPKDIDYVLMTHMHFDHAAGLTDQAGHANAIHVVQQDEWHEFIA-PNIRSKSTYWDKNKGDYSNKLILFEKHFEPVPG---IKMQHSGGHSFGHTIITIESQGD----KAVHMGDITTAHKNPLWVTAYDDYPMQSIREKERMIPYFIQQQYWFLFYHDENYFAVK........................................ 259
54 -29.3001qh3_A mol:protein length:260 PROTEIN (HYDROXYACYLGLUTATHIONE HYDROLASE)  ali model follow..  16  3.............VEVLPALTDNY--------MYLVIDDETAAIVDPV---QPQKVVDAARKHGVK---LTTVLTTHHHWDHAGGNEKLVKLEGLKVYGGDDRIGAL-----------------------THKITHLSTLQVGSLNVKCLATPCHTSGHICYFVSKPGGSETGDTLFVAGCGKF------------YEGTADEMCKALEVLGRLPPDTRVCGHEYTINNLKFARHVEPGNAAIREKLAWAKEKYSIGEPTVPSTLAEEFT. 220
55 -29.3003tp9_A mol:protein length:474 BETA-LACTAMASE and RHODANESE DOMAIN PROTEIN  ali model follow..  20  9.......................FYDEGLAHASYLVGCQETACVIDP--ARDVEPYLLTAKREGLR---IVAALETHIHADFVSGAREMADRAGAAICVSDEGPPEWKSEYVKAYPH--------------RLLKDGDELHFGNVRIVVMHTPGHTPEHVSYLLYDGKTSPSGDFVFVGDVGRPDLLERVAGESGSSEALARQMFRSLRKFEALPDHVQVPAHGAGSACGKALGAVPSSTVNWALQHKDEDAFVQALLA............ 241
56 -29.2004xuk_A mol:protein length:291 Putative hydrolase  ali model follow..  20  57.............................SINAFLVNIGKSLILIDSGAASHLGSVLSNLKASGYQPEQVDTILLTHLHPDHVCGISKDGVANNATVYVSNDEASFWLDPKQAAKLPKKQAIAPYQAKQRFKTYKLGDDIQ----GFKVINTAGHTPGHFSYELKTKGE----SIVFIGDI-QFDRPETAIEYDIDPKKAVETRLKQFANFAKNGQ-TIAAPHLPFPGIGHTYSADGKS................................ 281
57 -28.6003r2u_A mol:protein length:466 Metallo-beta-lactamase family protein  ali model follow..  15  24.......................FYDKHLSQASYLIGCQKTAMIIDP--IRDLSSYIRVADEEGLT---ITHAAETHIHADFASGIRDVAIKLNANIYVSGESDDTLGYKNMPNHT---------------HFVQHNDDIYVGNIKLKVLHTPGHTPESISFLLTDEGAGASGDFIFVGDIGRPDLLEKAVKVEGSSEIGAKQMFKSIESIKDLPDYIQIPGHGAGSPCGKSLGAIPTSTTNWAFSENNEATFIDKLIS............ 255
58 -28.6004zo2_A mol:protein length:294 Acylhomoserine lactonase  ali model follow..  18  58.............................AINILLVKTKEKLILMDTGMGIRTGFLLKSLQKAGFSAHDITDIFLSHAHPDHIGGVVDKQNKLNASIFISKIEHDFWINASIKDFNNSALKAHP-AIQPKLKFYDLNKTLYSH---FNFQLAPGHTPGLTVTTISSGNE----KLMYVADL-LFPHPDWGFSGDTDLDIATASRKKFLKQLADTKA-RAFTSH................................................ 269
59 -27.8004le6_A mol:protein length:324 Organophosphorus hydrolase  ali model follow..  20  88.............................AVNAYLINTGDNLVLIDTGAAQTLGVVQTNLKASGYQPEQVDTVLLTHLHPDHACGLVNADGSPNATVEVPQAEAEFWLDEATMAKAPEQQAVAPYAKMNKLKPYKTEGELLPG---VSLVASPGHTPGHTSYLFKSGGQ----SLLVWGDI-QFAKPEVVFEFDVDSDQARQSRQRILAEAATDKL-WVAGAHLPFPGLGHVRKEAQGYAWVP............................ 314
60 -27.7004o98_A mol:protein length:337 organophosphorus hydrolase  ali model follow..  20  88.............................AVNAYLINTGDNLVLIDTGAAQTLGVVQTNLKASGYQPEQVDTVLLTHLHPDHACGLVNADGSPNATVEVPQAEAEFWLDEATMAKAPERQAVAPYAKMNKLKPYKTEGELLPG---VSLVASSGHTPGHTSYLFKSGGQ----SLLVWGDI-QFAKPEVVWEFDVDSDQARQSRQRILAEAATDKL-WVAGAHLPFPGLGHVREEAQGYAWVP............................ 314
61 -27.6001p9e_A mol:protein length:331 Methyl Parathion Hydrolase  ali model follow..  21  96.............................SVTGYLVNTGSKLVLVDTGAAGTLGRLAANLKAAGYQPEQVDEIYITHMHPDHVGGLMVGEQLANAVVRADQKEADFWLSQTNLDKAPDDESKGFFKGAMASKPFSGNTDLVPG---IKALASHGHTPGHTTYVVESQGQ----KLALLGDL-QFDDPSVTTQLDSDSKSVAVERKKAFADAAKGGY-LIAASH................................................ 302
62 -27.0002p18_A mol:protein length:311 Glyoxalase II  ali model follow..  16  25.............VTVVPTLKDNF--------SYLINDHTTLAAVDV--NADYKPILTYIEEHLKQQGTFSTILSTHKHWDHSGGNAKLKAELEAVVVGGANDS------------------------AVTKPVREGDRVQVGDLSVEVIDAPCHTRGHVLYKVQHPQHPNDGVALFTGDTMFIAGIGAFFEGDEKCRAMEKVYHIHKGNDYALDKVTFIPGHEYTSGFMTFSEKTFPDRASDDLA-AKYAAAVKTGDPSVPSSLAEEKR. 272
63 -26.3001vme_A mol:protein length:410 Flavoprotein  ali model follow..  15  12.............TERIFDDPEIYVLRIDDYNAYLVKLNGANVLIDGWKGNYAKEFIDALSKI-VDPKEITHIIVNHTEPDHSGSLPATLKTIDVEIIASNFGKRLLEG---------------FYGIKDVTVVKDGEEREIGGKKFKFVMTP-HWPDTMGILFSCDVGGGYLLPEILDDSNESVVERYLPHVTKYIVTVIGHYLEGAEKLSSLKIKALLPGHGLI-NHYVSVAKGDPKKGKVTVIYDSMYGFVENVMKKAIDSLKEKGFT 290
64 -25.5004efz_A mol:protein length:298 Metallo-beta-lactamase family protein  ali model follow..  20  10.......................FFDPATCTISYLLFDSGSCALIDSVLDASADQLIARVAALGAR---VRWLLETHVHADHLSAAPYLKTRVGGEIAIGR---HVTRVQDVFGKLFNAGPAFAHDGSQFDRLLDDGDTLALGALSIRAMHTPGHTPACMTYVVTEAHAAHDARDAAAFVGDTLFMPDYGTARCDFPGGDARSLYRSIRKVLSLPPATLYMCHPNGRAIQYASTVADELRENVHIREGVTEDDFVAMRTARDATLDMPV.. 265
65 -25.0004ysk_A mol:protein length:294 Beta-lactamase domain protein  ali model follow..  19  12.......................FYDEATSTISYLVMDRETCALIDSVLDASADRLVERVNELNAS---VRWVLETHVHADHLSAAAYLKEKLGGHTAIGA---HITQVQKVFGALFNAEPGFARDGSQFDVLLEDEEGFRIGNLQARALHTPGHTPACMSFMIEDAGE----IAVFVGDT--LFMPDYGTARCDFPGADARTLYRSIRRLLAFPDQTLFMCHPGGRDMQYVTTVAEQRASNIHIHQGIDEDSFVAMREARDKTLEMPV.. 261
66 -24.9002q9u_A mol:protein length:414 A-type flavoprotein  ali model follow..  12  8.............VQDQEMIPGVYWVGIVDYNSYFID-DECPTVIDSVKYPFAEEWLSRIAAC-CPLDKIKYVVMNHAEGDHASSLKDHYHKFNATFVCTKKCQEHLKILYGMEKAT--------------LIVDDKYTLKIGKRTLKFIPVP-HWPDSTFTYCPEDK------LFSNDGFGQHYATSRRWADECDVSHVMHLMRKALEVASTVEIKYILSAHGVS-AEYDRWSKGQHCQKKVTVVLDSMYGTTHRMALALLDGARSTGCE 287
67 -24.7002qed_A mol:protein length:258 Hydroxyacylglutathione hydrolase  ali model follow..  20  10.............LNSIPAFQDNY--------IWVLTNDEGCVIVDPG---EAAPVLKAIAEHKWMPEAI---FLT----DHVGGVKELLQHFQMTVYGPAETQ------------------------GATHLVGDGDTIRVLGEKFTLFATPGHTLGHVCYFSRPY---FCGDTLFSGGCGRL------------FEGTPSQMYQSLMKINSLPDDTLICAHEYTLANIKFALSILPHDSFINEYYRKVKELRVKKQMTLPVILKNERK. 215
68 -24.4002ohh_A mol:protein length:404 Type A flavoprotein fprA  ali model follow..  16  3.............AAAKRISDGVYWTGVLDYNAYLVCGDEGVALIDNSYPGTFDELMARVEDAQVGMERVDYIIQNHVEKDHSGVLVELHRRFEAPIYCTEVAVKGLLKHYPSLREAEF------------MTVKTGDVLDLGGKTLTFLETP-HWPDSMFTLLDEDG------LFSNDAFGQHLCCPQRLDREIPEYILMDAVLKKFDEVKELRIQMIAPSHGQIWTDPMKI-ATGMVDERVTVIYDTMHGSTRKMAHAIAEGAMSEGVD 287
69 -23.4004fek_A mol:protein length:262 Putative diflavin flavoprotein A 5  ali model follow..  12  9.............VQVLPIATNTKVLRARSSNSYVIE-GDKTAIIDPPVESFMKIYLEALQQT-VNLKKLDYVILGHFSPNRIPTFKALLELAQITFVCSLPAAGDLRAAFPDDNLNI-------------LPMRGKETLDLGK-VLKFLPIP-RWPAGLCTYDVQTQILYTDKIFCGDDVFDDNWESFKEDQRYYFNCLMAPHEAALEKISDLQVRLYAVGHGPL............................................. 234
70 -23.0001e5d_A mol:protein length:402 RUBREDOXIN:OXYGEN OXIDOREDUCTASE  ali model follow..  12  1.............MQATKIIDGFHLVGAIDYNAYLVE-DEKTTLFDTVKAEYKGELLCGIASV-IDPKKIDYLVIQHLELDHAGALPALIEACPEKIFTSSLGQKAMESHFHYKDWP--------------QVVKHGETLSLGKRTVTFYETR-HWPDSMVSWFADEK------LISNDIFGQNIAASERFSDQIPVHTLERAMREYYANIAGVAPEFICPDHGVIFRGADQCTAEQKPTNKVVIFYDSMWHSTEKMARVLAESFRDEGCT 283
71 -22.4001ycf_A mol:protein length:398 Nitric oxide reductase  ali model follow..  13  2..............QPVAITDGIYWVGAVDYNAYLIV-DDKTALVDTVYEPFKEELIAKLKQI-KDPVKLDYLVVNHTESDHAGAFPAIMELCDAHVLCTQRAFDSLKAHYSHIDFN--------------TIVKTGTSVSLGKRSLTFIEAP-HWPDSMFTYVPEEA------LLPNDAFGQHIATSVRFDDQVDAGLIMDEAAKYYANIINLAIKTIAPSHGDPGRIIEAYARWAEGQGKAVIAYDTMWLSTEKMAHALMDGLVAGGCE 282
72 -21.0002p4z_A mol:protein length:284 Metal-dependent hydrolases of the beta-lactam  ali model follow..  12  29................................SLLLKKGNKEIVVDTG---QSENFIKNCGLMGIDVGRIKKVVLTHGHYDHIGGLKGLLERNPVKIYTHKEILN-TDITYDNEFTTKNFFVEKEGKRIPDKFLDEVFVVVKEEDGINVVTGCSHA-GILNILETARNRFGVSYISLIGGFHLRGMEE-------------EKVKDIARKIEEYGVKKVLTGHCTGIDEYGFLKSVLKDK............................... 266
73 -20.9004d02_A mol:protein length:479 ANAEROBIC NITRIC OXIDE REDUCTASE FLAVORUBREDO  ali model follow..  14  3................IVVKNNIHWVGQRDYNSYLIR-EEKNVLIDTVDHKFSREFVQNLRNE-IDLADIDYIVINHAEEDHAGALTELMAQIDTPIYCTANAIDSINGPEWN------------------NVVKTGDTLDIGNKQLIFVETP-HWPDSMMTYLTGDA------LFSNDAFGQHYCDEHLFNDEVDQTELFEQCQRYYANIFNLPVDMIATSHGNPTQIVELYLKWAADYQEDTIFYDTMSNNTRMMADAIAQGIAETDPR 278
74 -18.9002az4_A mol:protein length:429 hypothetical protein EF2904  ali model follow..  11  3..........SKAKTTVTFHSGILTIGG---TVIEVAYKDAHIFFDFGTEFRPELLVPELKDL--KDYQHTAVFLSHAHLDHSRMINYLDP--AVPLYTLKETKMILNSLNRKGDFLIPSPFEEKNFTREMIGLNKNDVIKVGEISVEIVPVDHDAYGASALLIRTPDH----FITYTGD----------LRLHGHNREETLAFCEKAKHTELLMMEGVSISFPEREDLVQHLVRLELENPNRQITFNGYPANVERFAKIIEKS....... 275
75 -18.4002i7t_A mol:protein length:459 Cleavage and polyadenylation specificity fact  ali model follow..  10  13.....................LIRPLGAGQ-SCIILEFKGRKIMLDCGIHPGLEGMDALPYIDLIDPAEIDLLLISHFHLDHCGALPWFLQKTSGRTFMTHATKAIYR-SNISADDMLYTETDLEESMDKIETINFHEVKEVAGIKFWCYHA-GHVLGAAMFMIEIAG----VKLLYTGDFSLIIESTYGTHIHEKREEREARFCNTVHDIVNRGGRGLIPVFA----LDEYWQNHPELHDIPIYYASSLAKKCMAVYQTYVNAMNDKIRK 295

FFAS is supported by the NIH grant R01-GM087218-01
1 1 8 0 3 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Ye Y, Godzik A. Comparative analysis of protein domain organization. Genome Res. 2004 Mar;14(3):343-53.